NSDHL Antilichaam - middelste regio : HRP (ARP47199 T100-HRP)

NAD (P) dependent steroid dehydrogenase-like

H105E3, XAP104, SDR31E1

50814

Q15738

NP_057006

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human NSDHL

NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene.

UBC; FUS; SUMO3

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

NSDHL is strongly supported by BioGPS gene expression data to be expressed in HepG2

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Guggenberger, C., J. Steroid Biochem. Mol. Biol. 104 (3-5), 105-109 (2007)

Wet Ice

373

NSDHL

NSDHL

Rabbit

Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating

NM_015922

RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN