NSUN3 Rabbit pAb (APR1957N)

Mitochondrial tRNA methyltransferase that mediates methylation of cytosine to 5-methylcytosine (m5C at position 34 of mt-tRNA (Met. mt-tRNA (Met methylation at cytosine (34 takes place at the wobble position of the anticodon and initiates the formation of 5-formylcytosine (f (5c at this position. mt-tRNA (Met containing the f (5c modification at the wobble position enables recognition of the AUA codon in addition to the AUG codon, expanding codon recognition in mitochondrial translation.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NSUN3 Rabbit pAb (APR19507N) .

NSUN3; MST077; MSTP077

63899

Q9H649

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 38kDa Observed MW: 38kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=63899

https://www.uniprot.org/uniprot/Q9H649

MLTQLKAKSEGKLAKQICKVVLDHFEKQYSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAAS