Numb Antibody - C-terminal regio : HRP (ARP59433 P050-HRP)

Numb gene homolog (Drosophila)

Nb, m-num

18222

Q9QZS3-2

NP_035079

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Numb plays a role in the process of neurogenesis. It is required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. It is not required for the proliferation of neural progenitor cells before the onset of neurogenesis. It is also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. It may also mediate local repair of brain ventricular wall damage.

Igsf5; Eed; Grin1; Cdh2; Cdh1; Ctnnb1; Ctnna1; Lnx2; Lnx1; Notch1; Eps15; Ehd1; Ehd4

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

66kDa

Wet Ice

604

NUMB

Numb

Rabbit

Protein numb homolog

NM_010949

ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF