NUP43 Antilichaam - middengebied: Biotine (ARP55922_P050-Biotine)

Nucleoporin 43kDa

P42, bA350J20.1

348995

Q8NFH3

NP_942590

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human NUP43

NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC) . The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BG567254.1 2-11 11-24 CB989591.1 28-41 25-47 AK074311.1 1-23 48-1751 AF514997.1 1-1704 1752-2581 BC047539.1 2681-3510 2582-2745 BC046637.1 2350-2513 2746-2818 BG527619.1 33-105 c 2819-3862 BC046637.1 2587-3630

UBC; SUMO1; SEH1L; DCTN2; TP53RK; RAB3GAP2; NUP107; UBD; ISG15; CUL4A; DDB1; Nup98; NUP37; NUP85; NUP133; NUP160

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Mehrle, A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Wet Ice

380

NUP43

NUP43

Rabbit

Nucleoporin Nup43

NM_198887

HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI