NXF5 Antilichaam - middengebied: Biotine (ARP41062_T100-Biotine)

Nuclear RNA export factor 5

55998

Q9H1B4

NP_116564

Human, Mouse, Rat, Dog, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human NXF5

NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2) -like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2) -like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.

NXF1

Biotin

Polyclonal Antibody

IHC, WB

0.5 mg/ml

Dog: 86%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

44kDa

Frints, S.G., (2003) Am. J. Med. Genet. A 119 (3), 367-374

Wet Ice

397

NXF5

NXF5

Rabbit

Nuclear RNA export factor 5

NM_032946

ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE