OPN5 Antilichaam - C-terminalgebied: FITC (ARP59823 P050-FITC)

Opsin 5

PGR12, GPR136, GRP136, TMEM13

221391

Q6U736

NP_859528

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human OPN5

Opsins are members of the guanine nucleotide-binding protein (G protein) -coupled receptor superfamily. This opsin gene is expressed in the eye, brain, testes, and spinal cord. This gene belongs to the seven-exon subfamily of mammalian opsin genes that includes peropsin (RRH) and retinal G protein coupled receptor (RGR) . Like these other seven-exon opsin genes, this family member may encode a protein with photoisomerase activity. Alternative splicing results in multiple transcript variants.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

Affinity purified

0.5 mg/ml

Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 92%; Rat: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

38 kDa

Wet Ice

354

OPN5

OPN5

Rabbit

Opsin-5

NM_181744.3

YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH