OR2H1 Antilichaam - C-terminalgebied: FITC (ARP59729 P050-FITC)

Olfactory receptor, family 2, subfamily H, member 1

OR2H6, OR2H8, OR6-2, 6M1-16, HS6M1-16, dJ994E9.4, OLFR42A-9004-14, OLFR42A-9004.14/9026.2

26716

Q9GZK4

NP_112145

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2H1

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

TINF2

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 85%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 92%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

35kDa

Wet Ice

316

OR2H1

OR2H1

Rabbit

Olfactory receptor 2H1

NM_030883

IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL