OTX1 Antilichaam - C-terminalgebied: FITC (ARP39103_T100-FITC)

Orthodenticle homeobox 1

5013

P32242

NP_055377

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human OTX1

OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.

KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP12-2; LCE2D; LCE2A; LCE1B; LCE4A; MGAT5B; KRTAP3-3; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP4-11; GEMIN8P4; KRTAP5-6; KRTAP26-1; KRTAP12-4; KRTAP3-2; KCNK16; KRTAP4-12; RGS17; RB

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Francks, C., et al., (2002) Psychiatr. Genet. 12 (1), 35-41

Wet Ice

354

OTX1

OTX1

Rabbit

Homeobox protein OTX1

NM_014562

HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW