
P38 MAPK Rabbit pAb (AMR00687N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality p38 MAPK Rabbit pAb (AMR00687N) .
MAPK14; CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; PRKM14; PRKM15; RK; SAPK2A; p38; p38ALPHA; p38 MAPK
1432
Q16539
Cytoplasm, Nucleus
WB (Mus musculus, Rattus norvegicus, Mactra veneriformis, Sus scrofa, crab, Homo sapiens)
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 29kDa/34kDa/35kDa/41kDa Observed MW: 41kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1432
https://www.uniprot.org/uniprot/Q16539
AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Beschrijving
P38 MAPK Rabbit pAb (AMR00687N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

ExactaCruz® Pipette Tip Reload System, 50-1250 μl, case
sc-201714
80 Racks/Case

Disc Membrane Hydrophobic PTFE, 0.22μm
CPTB14222
50 PCS

Rat Serum Albumin
CSB-NP000101r-01
1 mg

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg
Recent gezochte producten

BSA and BGG Stock standards (1 vial each @ 2 mg/ml) for BCA Optima Protein Assay kit
BSA-BGG-1
1 PK

General Bovine Serum Albumin (BSA) ELISA Kit
DL-BSA-Ge-01
48 Tests

General Bovine Serum Albumin (BSA) ELISA Kit
RD-BSA-Ge-01
96 Tests

Heparin
BSA-Hep-01 – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 50 mg
50 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 50 mg
50 mg
