
P53 Konijn pAb (APR18383N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277) .
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality p53 Rabbit pAb (APR18383N) .
TP53; BCC7; LFS1; P53; TRP53; Trp53; bbl; bfy; bhy; p44; p53; Tp53
22059
P02340
Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body
WB (rat cells, Rattus norvegicus, Homo sapiens) IHC (Rattus norvegicus)
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100 IP 1:50 - 1:200
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 43kDa Observed MW: 53KDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22059
https://www.uniprot.org/uniprot/P02340
SAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
Beschrijving
P53 Konijn pAb (APR18383N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

ExactaCruz® Pipette Tip Reload System, 50-1250 μl, case
sc-201714
80 Racks/Case

Disc Membrane Hydrophobic PTFE, 0.22μm
CPTB14222
50 PCS

Rat Serum Albumin
CSB-NP000101r-01
1 mg

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg
Recent gezochte producten

BSA and BGG Stock standards (1 vial each @ 2 mg/ml) for BCA Optima Protein Assay kit
BSA-BGG-1
1 PK

General Bovine Serum Albumin (BSA) ELISA Kit
DL-BSA-Ge-01
48 Tests

General Bovine Serum Albumin (BSA) ELISA Kit
RD-BSA-Ge-01
96 Tests

Heparin
BSA-Hep-01 – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 50 mg
50 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 50 mg
50 mg
