PABPN1 Konijn pAb (APR26249N)

This gene encodes an abundant nuclear protein that binds with high affinity to nascent poly (A) tails. The protein is required for progressive and efficient polymerization of poly (A) tails at the 3' ends of eukaryotic transcripts and controls the size of the poly (A) tail to about 250 nt. At steady-state, this protein is localized in the nucleus whereas a different poly (A) binding protein is localized in the cytoplasm. This gene contains a GCG trinucleotide repeat at the 5' end of the coding region, and expansion of this repeat from the normal 6 copies to 8-13 copies leads to autosomal dominant oculopharyngeal muscular dystrophy (OPMD) disease. Related pseudogenes have been identified on chromosomes 19 and X. Read-through transcription also exists between this gene and the neighboring upstream BCL2-like 2 (BCL2L2) gene.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PABPN1 Rabbit pAb (APR26249N) .

PABPN1; OPMD; PAB2; PABII; PABP-2; PABP2

8106

Q86U42

Cytoplasm, Nucleus

WB (Homo sapiens) IF (Homo sapiens)

WB 1:500 - 1:1000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 31kDa/32kDa/37kDa Observed MW: 45kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8106

https://www.uniprot.org/uniprot/Q86U42

MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE