PADI2, Cynomolgus (sf9, zijn)

The PADI2 protein plays a key role in cellular processes by catalyzing the deimination of protein arginine residues. This enzymatic activity, called citrullination, involves the conversion of arginine to citrulline, affecting the structure and function of the target protein. PADI2 Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived PADI2 protein, expressed by sf9 insect cells , with N-His labeled tag.

PADI2 Protein, Cynomolgus (sf9, His), Cynomolgus, sf9 insect cells

12352202

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSERVRVEVMRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEMVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCDLKVCFQYINRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFEPVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDKDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP

/ (Gene_ID) A0A2K5TST4 (M1-P665) (Accession)

Approximately 75-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Dry ice.

Recombinant Proteins