PAQR8 Rabbit pAb (APR188928N)

Plasma membrane progesterone (P4 receptor coupled to G proteins. Seems to act through a G (i mediated pathway. May be involved in oocyte maturation (By similarity. Also binds dehydroepiandrosterone (DHEA, pregnanolone, pregnenolone and allopregnanolone.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PAQR8 Rabbit pAb (APR18892N) .

PAQR8; C6orf33; LMPB1; MPRB

85315

Q8TEZ7

Cell membrane, Multi-pass membrane protein

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 40kDa Observed MW: 40kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=85315

https://www.uniprot.org/uniprot/Q8TEZ7

MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNE