PDSS2 Antilichaam - C-terminalgebied: FITC (ARP48856 P050-FITC)

Prenyl (decaprenyl) diphosphate synthase, subunit 2

DLP1, COQ1B, hDLP1, COQ10D3, C6orf210, bA59I9.3

57107

Q86YH6

NP_065114

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human PDSS2

The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone.The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 (PDSS1; MIM 607429) and DLP1 (PDSS2) that produces Q10 ubiquinone (Saiki et al., 2005 [PubMed 16262699]) .[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-24 DC341808.1 2-25 25-1292 BC039906.1 11-1278 1293-2534 AL832290.1 98-1339 2535-2535 BC039906.1 2521-2521 2536-3522 AL832290.1 1340-2326 3523-3568 AL832290.1 2328-2373

APP; ELAVL1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 92%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

44kDa

Hillier, L.W., (2007) J. Am. Soc. Nephrol. 18 (10), 2773-2780

Wet Ice

399

PDSS2

PDSS2

Rabbit

Decaprenyl-diphosphate synthase subunit 2

NM_020381

IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

2