PHF5A Antilichaam - middelste regio : HRP (ARP47695 P050-HRP)

PHD finger protein 5A

INI, Rds3, SF3B7, SAP14b, SF3b14b, bK223H9.2

84844

Q7RTV0

NP_116147

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human PHF5A

This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP) . The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes.

UBC; EZH2; BMI1; SUZ12; RNF2; SRPK3; FOXB1; PRPF31; SF3B5; RBM25; SF3B6; SF3B1; SF3B3; SF3B2; SF3B4; DDX23; SNRPB2; SNRPA1; SFPQ; S100A10; YBX1; NCL; HNRNPA1; DHX8; SF3A2; Sf3a1; SUMO2; RNU11; RNU12-2P

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

12kDa

Wet Ice

110

PHF5A

PHF5A

Rabbit

PHD finger-like domain-containing protein 5A

NM_032758

ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK