Pi4k2b Antilichaam - N-terminalgebied: FITC (ARP57203_P050-FITC)

Phosphatidylinositol 4-kinase type 2 beta

2610042N09Rik, 4933409G22Rik

67073

Q8CBQ5

NP_080227

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

The immunogen is a synthetic peptide corresponding to a region of Mouse

Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) Pi4k2b contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) . Pi4k2b contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

52kDa

Wet Ice

469

PI4K2B

Pi4k2b

Rabbit

Phosphatidylinositol 4-kinase type 2-beta

NM_025951

EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS