Pias2 Antilichaam - C-terminal regio : FITC (ARP36929 P050-FITC)

Protein inhibitor of activated STAT 2

Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6

17344

Q8C5D8

AAB96678

Human, Mouse, Cow, Dog, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2

Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It seems to be mostly involved in gene silencing. It binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity.

Pparg; Egr2; Plagl2; Trim32; Trp53; DHX9; Nfkb1; Gtf2i; GTF2IRD1; HDAC3

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

54kDa

Wet Ice

490

PIAS2

Pias2

Rabbit

E3 SUMO-protein ligase PIAS2

NM_001164167

LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE