PIGF Antibody - N-terminal regio : HRP (ARP404008 P050-HRP)

Phosphatidylinositol glycan anchor biosynthesis, class F

MGC32646, MGC33136

5281

Q07326

NP_002634

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep

The immunogen is a synthetic peptide directed towards the N terminal region of human PIGF

PIGF is a protein involved in glycosylphosphatidylinositol (GPI) -anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. This gene encodes a protein involved in glycosylphosphatidylinositol (GPI) -anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. The encoded protein and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI. Alternatively spliced transcript variants encoding different isoforms have been described.

PIGO; PIGG

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB, IHC

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 93%; Horse: 92%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%; Sheep: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

25kDa

Mohammed, K.A., Am. J. Physiol. Lung Cell Mol. Physiol. 292 (2), L559-L566 (2007)

Wet Ice

219

PIGF

PIGF

Rabbit

Phosphatidylinositol-glycan biosynthesis class F protein

NM_002643

MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF