Pkn2 Antilichaam - C-terminal regio : HRP (ARP61895 P050-HRP)

Protein kinase N2

PR, Prk, Stk, PRK2, Stk7, Prkcl2, AI507382, 6030436C20Rik

109333

Q8BWW9

NP_848769

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pkn2

Pkn2 is a PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. It plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Pkn2 phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin, phosphorylates HDAC5, therefore lead to impair HDAC5 import. It is a direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells and is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. It stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation, regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion, inhibits Akt pro-survival-induced kinase activity. It mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF) .

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

111kDa

Wet Ice

983

PKN2

Pkn2

Rabbit

Serine/threonine-protein kinase N2

NM_178654

LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE