Plasminogeen, menselijk

Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

Plasminogen Protein, Human, Human, E. coli

12352202

95.00

VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

5340 (Gene_ID) P00747 (V98-P356) (Accession)

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins