POU2F3 Antilichaam - C-terminal regio : HRP (ARP57992_P050-HRP)

POU class 2 homeobox 3

PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a

25833

Q9UKI9

NP_001231611.1

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3

This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

24kDa

Wet Ice

221

POU2F3

POU2F3

Rabbit

POU domain, class 2, transcription factor 3

NM_001244682.1

LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN