POU3F3 Antilichaam - N-terminaal gebied: Biotine (ARP33062_P050-Biotin)

POU class 3 homeobox 3

BRN1, OTF8, oct-8, SNIBFIS, brain-1

5455

P20264

NP_006227

Human, Mouse, Rat

The immunogen is a synthetic peptide directed towards the N terminal region of human POU3F3

POU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3') .POU3F3 is a member of the class III POU family of transcription factors (see POU3F1; MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082].[supplied by OMIM].

Dlg4; SOX8; PPP1R15A; SOX10; SOX11; POU3F4

Biotin

Polyclonal Antibody

WB

Affinity Purified

POU3F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

0.5 mg/ml

Human: 100%; Mouse: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

50kDa

Wissmuller, S., (2006) (er) Nucleic Acids Res. 34 (6), 1735-1744

Wet Ice

500

POU3F3

POU3F3

Rabbit

POU domain, class 3, transcription factor 3

NM_006236

GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAA