POU6F2 Antilichaam - N-terminal regio : HRP (ARP38928 P050-HRP)

POU class 6 homeobox 2

WT5, WTSL, RPF-1

11281

P78424

NP_009183

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human POU6F2

POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways.POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-60 AC011292.3 84260-84319 61-553 U91935.1 102-594 554-927 AC005483.1 150160-150533 c 928-1068 AC005483.1 83435-83575 c 1069-1275 AC005483.1 56892-57098 c 1276-1613 U91935.1 1320-1657 1614-2223 AC005483.1 25384-25993 c

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

73kDa

Perotti, D., (2004) Hum. Mutat. 24 (5), 400-407

Wet Ice

691

POU6F2

POU6F2

Rabbit

POU domain, class 6, transcription factor 2

NM_007252

AATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQ