Ppargc1a Antilichaam - C-terminalgebied: HRP (ARP39016 P050-HRP)

Peroxisome proliferative activated receptor, gamma, coactivator 1 alpha

Pgc, Pgc1, PGC-1, Pgco1, Gm11133, Ppargc1, Pgc-1alpha, A830037N07Rik, PPARGC-1-alpha

19017

O70343

NP_032930

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide corresponding to a region of Mouse

Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.

Yy1; Akt1; Pparg; Cdk7; Mybbp1a; Sirt1; Hnf4a; Nr5a1; Lhb; NR1I2; Esrra; Nr1h3; Ncoa1; Foxo1; Pck1; G6pc

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

90kDa

Wet Ice

797

PPARGC1A

Ppargc1a

Rabbit

Peroxisome proliferator-activated receptor gamma coactivator 1-alpha

NM_008904

LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD