PPIE Antilichaam - middengebied: FITC (ARP40627 T100-FITC)

Peptidylprolyl isomerase E (cyclophilin E)

CYP33, CYP-33

10450

Q9UNP9

NP_006103

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast

The immunogen is a synthetic peptide directed towards the middle region of human PPIE

PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.

XAB2; BMI1; UBC; EIF4A3; MAGOH; SF3A2; HHV8GK18_gp81; SUMO2; Prpf8; Cdc5l; Snw1; KMT2A; PHYHIP

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

PPIE is strongly supported by BioGPS gene expression data to be expressed in K562

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Yeast: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

33kDa

Fair, K., (2001) Mol. Cell. Biol. 21 (10), 3589-3597

Wet Ice

301

PPIE

PPIE

Rabbit

Peptidyl-prolyl cis-trans isomerase E

NM_006112

KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP