Ppp1ca Antilichaam - C-terminal regio : HRP (ARP62624 P050-HRP)

Protein phosphatase 1, catalytic subunit, alpha isozyme

Pp, dis, Ppp1c, dism2

19045

P62137

NP_114074

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca

Ppp1ca is a protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Regulates NEK2 function in terms of kinase activity and centrosome number and splitting, both in the presence and absence of radiation-induced DNA damage. Regulator of neural tube and optic fissure closure, and enteric neural crest cell (ENCCs) migration during development.

Eed; Plcb1; Wbp11; SH3KBP1; Ccnb1; Atr; Eif2a; Cdc34; Ppp2r4; Lbr; Tsc1; Skp1a; Pcna; Nek2; Mapt; Max; Id2; Hspa1b; Ptk2; Cdkn2a; Ccne1; Ccnd3; Ccna1; Bcl2; Atm; Apaf1; Pou5f1; Apc; SNCA; TGFBR1; Stau1; Ppp1r9b; Ppp1r9a

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Wet Ice

330

PPP1CA

Ppp1ca

Rabbit

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

NM_031868

RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS