PPP2R5A Antilichaam - N-terminaal gebied: Biotine (ARP48033 P050-Biotin)

Protein phosphatase 2, regulatory subunit B', alpha

B56A, PR61A, B56alpha

5525

Q15172

NP_006234

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R5A

PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

ESPL1; PTTG1; UBC; CBX5; Mdm2; Ccng1; PYGM; NEK1; CHEK2; Soga1; Sgol1; Sgol2; Ppp2r1a; AXIN1; MYC; GNL3; TP63; SHC1; CSNK1A1; EIF2AK2; APC; NOS3; MAPT; BEST1; BCL2; JAK2; CTLA4; PPP2R1B; PPP2CA; PPP2R5C

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

56kDa

Gregory, S.G., (2006) Nature 441 (7091), 315-321

Wet Ice

486

PPP2R5A

PPP2R5A

Rabbit

Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform

NM_006243

YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Alpha isoform