
PSMD4 Antilichaam - N-terminaal gebied: Biotine (ARP58060 P050-Biotine)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5
5710
P55036
NP_002801
• Rabbit
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
UBC; cdc20; XPC; SPRTN; PSMD14; MDM2; PSMC2; PSMA1; ADRM1; UBQLN1; TXNL1; PSMD3; PSMD2; PSMD1; PSMC6; PSMC4; PSMC1; UCHL5; RPS12; PSMD8; UBQLN4; VCP; GJA1; DIO2; SCHIP1; FBXO6; PARK2; UL76; FBXO25; LOC100044627; Gm4705; LOC677113; Rps6-ps4; Rpl34-ps1; Rpl
• Polyclonal
Biotin
Polyclonal Antibody
WB
Affinity Purified
PSMD4 is supported by BioGPS gene expression data to be expressed in Jurkat
0.5 mg/ml
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 100%
Liquid. Purified antibody supplied in 1x PBS buffer.
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
41kDa
Elangovan, M., (2007) Biochem. Biophys. Res. Commun. 364 (2), 226-230
Wet Ice
377
PSMD4
PSMD4
Rabbit
26S proteasome non-ATPase regulatory subunit 4
NM_002810
VLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGL
4
Beschrijving
PSMD4 Antilichaam - N-terminaal gebied: Biotine (ARP58060 P050-Biotine) Beschikbaar in 100 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Anti- Protein A Antibody
GWB-E66F30
1 mL

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg
