Ptges2 Antilichaam - N-terminaal gebied: Biotine (ARP37463 P050-Biotine)

Prostaglandin E synthase 2

Gbf1, Pges2, C79137, Mpges2, 0610038H10Rik

96979

Q8BWM0

NP_598544

Human, Mouse, Rat

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Ptges2

The protein encoded by this gene is a Golgi membrane-associated prostaglandin E synthase candidate, which is capable of catalyzing the conversion of prostaglandin H2 to prostaglandin E2 in vitro. However, a study using mice deficient of this gene suggests that this enzyme does not contribute to prostaglandin E2 biosynthesis in vivo. This protein is synthesized as a Golgi membrane-bound protein, but its N-terminal hydrophobic region is cleaved off during protein maturation to produce the predominant soluble truncated form that still retains the enzyme activity. This soluble protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE), possibly via an interaction with CAAAT/enhancer-binding protein-beta.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 79%; Mouse: 100%; Rat: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

43kDa

Wet Ice

384

PTGES2

Ptges2

Rabbit

Prostaglandin E synthase 2

NM_133783

RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ