RAD23B Antilichaam - middengebied: Biotine (ARP56505 P050-Biotine)

RAD23 homolog B (S. cerevisiae)

P58, HR23B, HHR23B

5887

P54727

NP_002865

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human RAD23B

The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER) . This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

PNMA5; NGLY1; PUF60; XPC; UBC; PSMD14; SHFM1; PDE12; NPLOC4; UBA6; PDLIM5; DRAP1; PLIN3; NUBP2; UBA2; EIF4A3; XPNPEP1; PKM; NUCB1; GTF2I; CBS; ADSL; PARK2; Rpl18; Rpl10a; Rac2; LOC100044627; Gm4705; Vmn2r101; Rpl34-ps1; Rpl5; Eno1b; Xpnpep3; Hist1h2bg; Hi

Biotin

Polyclonal Antibody

WB, IHC

Affinity Purified

RAD23B is strongly supported by BioGPS gene expression data to be expressed in MCF7

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

43kDa

Wet Ice

409

RAD23B

RAD23B

Rabbit

UV excision repair protein RAD23 homolog B

NM_002874

QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP