Rag1 Antilichaam - C-terminalgebied: FITC (ARP42949_P050-FITC)

Recombination activating gene 1

Rag, Rag-1

19373

P15919

NP_033045

Mouse, Rat, Horse, Pig

The immunogen is a synthetic peptide corresponding to a region of Mouse

As a catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V (D) J recombination. V (D) J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments. In the RAG complex, RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyzes the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment. RAG2 is not a catalytic component but is required for all known catalytic activities.

Gmeb1; Sf3a2; Kpna2; Rag1; UBE2C; UBE2H; UBE2E1; UBE2D2; UBE2D1; UBC; CDC34; Trav6-3; Rel; Nfkb1; Rela

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Horse: 100%; Mouse: 100%; Pig: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

119kDa

Wet Ice

1040

RAG1

Rag1

Rabbit

V (D) J recombination-activating protein 1

NM_009019

IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT