
RaGHBP Recombinant eiwit
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source : Escherichia Coli. Growth Hormone Binding Protein Rabbit Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 48 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques. GHBP is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized.
GHR||GHBP||GH receptor||Somatotropin receptor.
Greater than 98.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/mL) solution with 0.0045mM NaHCO3.
Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.
Beschrijving
Source : Escherichia Coli. Growth Hormone Binding Protein Rabbit Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248
Specificaties
Recent bekeken producten

Biotin-Recombinant (sf9) Marburg virus glycoprotein (Musoke, HA-tag, >95%), purified
MVGP16-BTN
100 µL

MARV VP40/Marburg VP40 Protein (N-His, Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980) ) )
P505862
100 µg

Hettich Centrifuge Rotanta 460R Refrigerated Large Volume
CEN0703
1 Each

X4RF Refrigerated Centrifuge
75009936
1 Each

Drug Stability Chamber
500-DSC102
1 Unit

Modular Incubator Chamber
MIC-101
1 Unit

CYP707A2 Antibody
GTR17947107
2 mg

SsDNA Assay Kit
12645ES60
100 Tests
