RBPMS Antilichaam - middelste regio : HRP (ARP40271_P050-HRP)

RNA binding protein with multiple splicing

HERMES

11030

Q569H2

NP_001008712

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human RBPMS

RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus. This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.

CRBN; ILF3; DOK6; ZNF385C; TEX37; WDR90; PAPD4; TOR1AIP2; ATP6V0E2; SH3RF2; DCDC2B; LOC148413; MGAT5B; SPATA8; RDH12; LOC142937; GLYCTK; NEU4; C22orf39; LRRC75A-AS1; PRR20A; ZNF488; DTX2; NAPRT; HNRNPLL; RIPPLY1; LONRF1; FBF1; C1orf94; ZC3H10; C9orf24; LI

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

RBPMS is supported by BioGPS gene expression data to be expressed in MCF7

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

24kDa

Lim, J., (2006) Cell 125 (4), 801-814

Wet Ice

219

RBPMS

RBPMS

Rabbit

RNA binding protein with multiple splicing EMBL AAH92476.1

NM_001008712

PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC