RDM1 Antilichaam - middengebied: FITC (ARP51853_P050-FITC)

RAD52 motif 1

RAD52B

201299

A8MY68

NP_001030008

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human RDM1

RDM1 is a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. It contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization.This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization. Alternatively spliced transcript variants encoding different isoforms have been reported.

MRFAP1L1; UBC

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 83%; Dog: 93%; Guinea Pig: 91%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

26kDa

Messaoudi, L., (2007) Nucleic Acids Res. 35 (19), 6571-6587

Wet Ice

236

RDM1

RDM1

Rabbit

RAD52 motif-containing protein 1 Ensembl ENSP00000378036

NM_001034836

NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF