Recombinant adipocyten Adhesie Molecule/ASAM/CLMP/ACAM (C-6His)
Gecertificeerd

Recombinant adipocyten Adhesie Molecule/ASAM/CLMP/ACAM (C-6His)

Catalog #: 32-7381-10
Maat: 10 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :25.38kD. Recombinant Human Adipocyte Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Thr19-Met233 is expressed with a 6His tag at the C-terminus. Adipocyte Adhesion Molecule (ASAM) is a type I transmembrane protein and member of the CTX family within the immunoglobulin superfamily. ASAM may be involved in the cell-cell adhesion, play an important role in adipocyte differentiation and development of obesity. ASAM can be expressed in the skeletal, heart, colon, spleen, muscle, lung and kidney with high level, and in the peripheral blood leukocytes and liver with low level. The extracellular region of ASAM consists two potential N-linked glycosylation sites, and two immunoglobulin domains, one V-type and one C2-type.

Gene Name

CLMP

Gene ID

79827

UniProt

Q9H6B4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVDHHHHHH

Beschrijving

Source: Human Cells. MW :25.38kD. Recombinant Human Adipocyte Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Thr1

Specificaties

ProductnaamRecombinant adipocyten Adhesie Molecule/ASAM/CLMP/ACAM (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-7381-10