Recombinant Carassius Auratus Leptine (N-8His)

Source: E.coli. MW :18.3kD. Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus. Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. In mammals, leptin is mainly produced by the adipose tissue and encodes body fat reserves, acting as a short-term satiety signal. In fish, the presence of a leptin-like peptide was first evidenced by immuno-cross-reactivity [14], and its existence was certainly demonstrated after the finding by synteny of a leptin sequence in the pufferfish.

Ob

B8YI02

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC