
Recombinant Cynomolgus B7-1/CD80 (C-6His)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Source: E. coli. MW :24.7kD. Recombinant Cynomolgus monkey T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cynomolgus Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily.It is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.CD80 plays key, yet distinct roles in the activation of T cells. B7-1/CD80 and B7-2/CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T- and B- cell responses. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response. CD80 is thus regarded as promising therapeutic targets for autoimmune diseases and various carcinomas.
CD80
732518
G7MKE2
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
The product is shipped on dry ice/ice packs.
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNHHHHHH
Beschrijving
Source: E. coli. MW :24.7kD. Recombinant Cynomolgus monkey T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target ge
Specificaties
Recent bekeken producten

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg

Anti-KIR2DL1 (Rabbit, Monoclonal, Rabbit mAb)
A115392
100 µL

Stains-all
03943-5
5 g

Sudan Blue II;Oil Blue 35
TRC-S688913-500MG
500 mg

Nile Blue A
N8430-01
1 g

Human Apolipoprotein E2 (Apo E2) Antibody
22210-05011
150 µg
