Recombinant Cynomolgus B7-1/CD80 (C-6His)
Gecertificeerd

Recombinant Cynomolgus B7-1/CD80 (C-6His)

Catalog #: 32-8817-10
Maat: 10 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :24.7kD. Recombinant Cynomolgus monkey T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cynomolgus Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily.It is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.CD80 plays key, yet distinct roles in the activation of T cells. B7-1/CD80 and B7-2/CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T- and B- cell responses. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. Although both CTLA-4 and CD28 can bind to the same ligands, CTLA-4 binds to B7-1 and B7-2 with a 20-100 fold higher affinity than CD28 and is involved in the down-regulation of the immune response. CD80 is thus regarded as promising therapeutic targets for autoimmune diseases and various carcinomas.

Gene Name

CD80

Gene ID

732518

UniProt

G7MKE2

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDNHHHHHH

Beschrijving

Source: E. coli. MW :24.7kD. Recombinant Cynomolgus monkey T-lymphocyte Activation Antigen CD80 is produced by our Mammalian expression system and the target ge

Specificaties

ProductnaamRecombinant Cynomolgus B7-1/CD80 (C-6His)
Categorie
Beschikbare grootte10 µg
Catalogusnummer32-8817-10