Recombinant E. coli RNA Pyrofosfohydrolase/rppH
Gecertificeerd

Recombinant E. coli RNA Pyrofosfohydrolase/rppH

Catalog #: 32-8693-50
Maat: 50 µg
Droogijs Vereist

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E.coli. MW :20.8kD. Recombinant E.coli RNA pyrophosphohydrolase is produced by our E.coli expression system and the target gene encoding Met1-Gly176 is expressed. Messenger RNA (mRNA) degradation plays a key role in the control of gene expression in all organisms by limiting the number of times that each mRNA molecule can be used as a template for protein synthesis. RNA pyrophosphohydrolase, also called RppH, is a master regulator of 5'-dependent mRNA decay. It accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage. RppH preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products, and can be able to hydrolyze diadenosine hexa- and tetra-phosphate. However, this protein has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP-glucose. In the meningitis causing strain E.coli K1, it has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro.

Gene Name

RppH

Gene ID

947300

UniProt

P0A776

Components

Supplied as a 0.2 μm filtered solution of 50mM Tris, 500mM NaCl, 10% glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG

Beschrijving

Source: E.coli. MW :20.8kD. Recombinant E.coli RNA pyrophosphohydrolase is produced by our E.coli expression system and the target gene encoding Met1-Gly176 is

Specificaties

ProductnaamRecombinant E. coli RNA Pyrofosfohydrolase/rppH
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8693-50