Recombinant humaan a-N-acetylneuraminide a-2,8-Sialyltransferase/ST8SIA1 (C-6His)

Source: Human Cells. MW :36.2kD. Recombinant Human ST8SIA1 is produced by our Mammalian expression system and the target gene encoding Tyr49-Ser356 is expressed with a 6His tag at the C-terminus. a-N-Acetylneuraminide a-2,8-Sialyltransferase (ST8SIA1) belongs to the glycosyltransferase 29 family. ST8SIA1 is a sialytransferase that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce GD3 and GT3. ST8SIA1 is highly expressed in melanoma cell lines, adult and fetal brain, low expressed in adult and fetal lung. ST8SIA1 may act as a type II transmembrane protein with a short N-termianl cytoplasmic domain and a single-pass transmembrane domain folowed by an enzymatic domain in the lument of the Golgi apparatus.

ST8SIA1

6489

Q92185

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl, pH8.0.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTSVDHHHHHH