Recombinant humaan a-taxiline/TXLNA (N, C-6His)
Gecertificeerd

Recombinant humaan a-taxiline/TXLNA (N, C-6His)

Catalog #: 32-8237-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: E. coli. MW :20.4kD. Recombinant Human alpha-Taxilin is produced by our E.coli expression system and the target gene encoding Met1-Lys162 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. a-Taxilin belongs to the taxilin family. a-Taxilin exists in almost all tissues, with higher expression levels observed in the heart, kidney, liver, and pancreas. a-Taxilin binds to the C-terminal coiled coil region of syntaxin family members STX1A, STX3A, and STX4A, but not when these proteins are complexed with SNAP25, VAMP2 or STXBP1, suggesting that it interacts with syntaxins that do not form the SNARE complex. It is shown that a-Taxilin plays multiple roles in the generation and maintenance of neurons through modulation of the NAC-mediated translational machinary and/or the syntaxin-mediated vesicle traffic in the soma. In addition, a-Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.

Gene Name

TXLNA

Gene ID

200081

UniProt

P40222

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH

Beschrijving

Source: E. coli. MW :20.4kD. Recombinant Human alpha-Taxilin is produced by our E.coli expression system and the target gene encoding Met1-Lys162 is expressed w

Specificaties

ProductnaamRecombinant humaan a-taxiline/TXLNA (N, C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8237-50