Recombinant humaan acrosomaal eiwit SP-10/ACRV1 (C-6His)
Gecertificeerd

Recombinant humaan acrosomaal eiwit SP-10/ACRV1 (C-6His)

Catalog #: 32-7377-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :26.9kD. Recombinant Human Acrosomal Protein SP-10 is produced by our Mammalian expression system and the target gene encoding Gln22-Ile265 is expressed with a 6His tag at the C-terminus. Acrosomal Protein SP-10 is a testis-specific differentiation antigen that is associated with acrosomal membranes and matrix of mature sperm. It has been detected in several species including humans. Acrosomal Protein SP-10 may be involved in sperm-zona binding or penetration as a potential contraceptive vaccine immunogen for humans. ACRV1 is also a intra-acrosomal protein that is considered to be a vaccine candidate for immunocontraception.

Gene Name

ACRV1

Gene ID

56

UniProt

P26436

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKIVDHHHHHH

Beschrijving

Source: Human Cells. MW :26.9kD. Recombinant Human Acrosomal Protein SP-10 is produced by our Mammalian expression system and the target gene encoding Gln22-Ile

Specificaties

ProductnaamRecombinant humaan acrosomaal eiwit SP-10/ACRV1 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7377-50