Recombinant humaan Apolipoproteïne A-II/ApoA2 (C-6His)

Source: Human Cells. MW :9.74kD. Recombinant Human Apolipoprotein A-II is produced by our Mammalian expression system and the target gene encoding Gln24-Gln100 is expressed with a 6His tag at the C-terminus. Apolipoprotein A-II (Apo-AII for short), also known as Apolipoprotein A2, is a secreted protein which belongs to the apolipoprotein A2 family. It exists as a disulfide-linked homodimer; and also can form a disulfide-linked heterodimer with APOD. APOA2 is the 2nd most abundant protein of the high density lipoprotein particles. This protein may stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Defects in APOA2 gene might cause apolipoprotein A-II deficiency or hypercholesterolemia.

APOA2

336

P02652

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQVDHHHHHH