Recombinant humaan Basal Cell Adhesie Molecule/BCAM (C-6His)
Gecertificeerd

Recombinant humaan Basal Cell Adhesie Molecule/BCAM (C-6His)

Catalog #: 32-8999-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :57kD. Recombinant Human Basal Cell Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Glu32-Ala547 is expressed with a 6His tag at the C-terminus. Basal cell adhesion molecule (BCAM, CD239) is an immunoglobulin superfamily protein that arises from alternate splicing of the Lutheran blood group molecule (Lu) . The ECD of human BCAM contains two Ig-like V-type domains and three Ig-like C2-type domains. It shares 73% aa sequence identity with the ECDs of mouse and rat BCAM. BCAM is widely expressed in epithelial and endothelial tissues including in the vasculature, kidney glomerulus, small intestine, colon, hair follicle outer root sheath, and basal keratinocytes of the skin during inflammation. BCAM is also expressed on vascular and visceral smooth muscle cells and at the neuromuscular junction of skeletal muscle. BCAM is upregulated on carcinomas, particularly ovarian, sarcomas, astrocytomas, and melanomas. It may mediate intracellular signaling. It cooperates with Integrins beta1 and aV beta3 as an adhesion receptor for Laminins which contain the a5 chain. The Lutheran isoform is aberrantly phosphorylated in erythroid disorders and can enhance Lamininmediated adhesion of erythrocytes to vascular endothelial cells.

Gene Name

BCAM

Gene ID

4059

UniProt

P50895

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAHHHHHH

Beschrijving

Source: Human Cells. MW :57kD. Recombinant Human Basal Cell Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Glu32-

Specificaties

ProductnaamRecombinant humaan Basal Cell Adhesie Molecule/BCAM (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-8999-50