Recombinant humaan Bcl-2-achtige proteïne 2/BCL2L2 (C-6His)

Source: E.coli. MW :19.87kD. Recombinant Human B Cell Lymphoma is produced by our E.coli expression system and the target gene encoding Ala2-Thr172 is expressed with a 6His tag at the C-terminus. Bcl-2-like protein 2 (BCL2L2) belongs to the Bcl-2 family. BCL2L2 is highly expressed in thebrain, spinal cord, testis, pancreas, heart, spleen, and mammary glands. BCL2L2 is a peripheral membrane protein containing three motifs, BH1, BH2 and BH4. The BH4 motif appears to be involved in the anti-apoptotic function. The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. BCL2L2 promotes cell survival and blocks dexamethasone-induced apoptosis. Furthermore, BCL2L2 mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.

BCL2L2

599

Q92843

Supplied as a 0.2 μm filtered solution of 25mM HEPES, 100mM KCl, 20% Glycerol, pH 7.5.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTLEHHHHHH