Recombinant humaan Bcl-2 gerelateerd eiwit A1/BCL2A1 (C-6His)

Source: E.coli. MW :18.52kD. Recombinant Human Bcl-2 Related Protein A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser152 is expressed with a 6His tag at the C-terminus. Bcl-2-Related Protein A1 (BCL2A1) is a member of of the BCL-2 protein family which act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. BCL2A1 is a cytoplasm protein and interacts directly with BAK1, BID, BMF and BBC3. BCL2A1 is induced by phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors. BCL2A1 is invovled in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection.

BCL2A1

597

Q16548

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.

The product is shipped on dry ice/ice packs.

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSLEHHHHHH