Recombinant humaan BOC-eiwit/BOC (C-6His)
Gecertificeerd

Recombinant humaan BOC-eiwit/BOC (C-6His)

Catalog #: 32-7619-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :14.2kD. Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed with a 6His tag at the C-terminus. Brother of CDO is a protein that in humans is encoded by the BOC gene. CDON and BOC are cell surface receptors of the immunoglobulin (Ig) /fibronectin type III repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.

Gene Name

BOC

Gene ID

91653

UniProt

Q96DN7

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSVDHHHHHH

Beschrijving

Source: Human Cells. MW :14.2kD. Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed wit

Specificaties

ProductnaamRecombinant humaan BOC-eiwit/BOC (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7619-50