Recombinant humaan C-C Motif Chemokine 3-Like 1/CCL3L1 (C-6His)

Source: Human Cells. MW :8.82kD. Recombinant Human C-C Motif Chemokine 3-Like 1 is produced by our Mammalian expression system and the target gene encoding Ala24-Ala93 is expressed with a 6His tag at the C-terminus. C-C Motif Chemokine 3-Like 1 (CCL3L1) is a secreted protein that belongs to the intercrine beta (chemokine CC) family. CCL3L1 is a ligand for CCR1, CCR3 and CCR5. CCL3L1 binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5) . CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The processed form LD78-beta (3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. The copy number of this gene varies among individuals: most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene (CCL3L3 and CCL3L1) and a partial pseudogene. This record represents the more centromeric full-length gene.

CCL3L1

414062

P16619

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLEPSAVDHHHHHH