Recombinant humaan C-C Motif Chemokine 5/CCL5/RANTES

Source: E.coli. MW :7.8kD. Recombinant Human C-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Ser24-Ser91 is expressed. Human Chemokine (C-C Motif) Ligand 5 (CCL5) plays an active role in recruiting leukocytes into inflammatory sites. CCL5 is secreted by many cell types at inflammatory sites and it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, and CCR5. N-Terminal truncated CCL5/RANTES, Met-RANTES, and amino-oxypentane (AOP) -RANTES exhibit antagonist or partial agonist functions on their receptors. CCL5/RANTES attracts different subtypes of leukocytes into inflamed tissue and intervenes in a wide range of allergic and autoimmune diseases.

CCL5

6352

P13501

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

The product is shipped at ambient temperature.

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS