Recombinant humaan C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His)
Gecertificeerd

Recombinant humaan C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His)

Catalog #: 32-7930-50
Maat: 50 µg

Kwaliteit

ISO Gecertificeerd

Levering

24-48 uur

Prijs -1%
Login voor prijs
BTW niet inbegrepen
Gratis verzending vanaf €100
Technische Documentatie

Technische Specificaties

Description

Source: Human Cells. MW :9.95kD. Recombinant Human C-C Motif Chemokine 8 is produced by our Mammalian expression system and the target gene encoding Gln24-Pro99 is expressed with a 6His tag at the C-terminus. Human Chemokine (C-C Motif) Ligand 8 (CCL8) is produced by human MG63 osteosarcoma cells. CCL8 shares 62% and 58% amino acid sequence identity with MCP-1 and MCP-3, respectively. All three MCP proteins are monocyte chemoattractants. CCL8 is chemotactic for and activates many different immune cells, including mast cells, eosinophils and basophils, which are implicated in allergic response, and monocytes, T cells, and NK cells that are involved in the inflammatory response. CCL8 elicits its effects by binding to several different cell surface receptors including CCR1, CCR2B and CCR5.

Gene Name

CCL8

Gene ID

6355

UniProt

P80075

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKPVDHHHHHH

Beschrijving

Source: Human Cells. MW :9.95kD. Recombinant Human C-C Motif Chemokine 8 is produced by our Mammalian expression system and the target gene encoding Gln24-Pro99

Specificaties

ProductnaamRecombinant humaan C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His)
Categorie
Beschikbare grootte50 µg
Catalogusnummer32-7930-50